![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries) |
![]() | Domain d2fx8l1: 2fx8 L:1-107 [134288] Other proteins in same PDB: d2fx8h1, d2fx8h2, d2fx8i1, d2fx8i2, d2fx8j1, d2fx8j2, d2fx8k1, d2fx8k2, d2fx8l2, d2fx8m2, d2fx8n2, d2fx8o2 automatically matched to d1rhha1 |
PDB Entry: 2fx8 (more details), 2.2 Å
SCOPe Domain Sequences for d2fx8l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx8l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevk
Timeline for d2fx8l1: