SCOPe 2.04: Domain d2fx3a2: 2fx3 A:297-392

Lineage for d2fx3a2 (2fx3 A:297-392)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (8 PDB entries)
   Uniprot P02990

8. Domain d2fx3a2: 2fx3 A:297-392 [134272]
   Other proteins in same PDB: d2fx3a1, d2fx3a3
   automatically matched to d1d8ta2
   complexed with gdp, mg

Details for d2fx3a2

PDB Entry: 2fx3, 3.4 Å

PDB Description: Crystal Structure Determination of E. coli Elongation Factor, Tu using a Twinned Data Set

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d2fx3a2:

Sequence; same for both SEQRES and ATOM records:

>d2fx3a2 b.44.1.1 (A:297-392) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvl

Timeline for d2fx3a2:

• d2fx3a2 first appeared in SCOP 1.73
  
• d2fx3a2 appears in SCOPe 2.03
  
• d2fx3a2 appears in SCOPe 2.05
  
• d2fx3a2 appears in the current release, SCOPe 2.08