Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Escherichia coli [TaxId:562] [50450] (8 PDB entries) Uniprot P02990 |
Domain d2fx3a1: 2fx3 A:205-296 [134271] Other proteins in same PDB: d2fx3a2, d2fx3a3 automatically matched to d1d8ta1 complexed with gdp, mg |
PDB Entry: 2fx3 (more details), 3.4 Å
SCOPe Domain Sequences for d2fx3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx3a1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d2fx3a1: