Lineage for d2fx3a1 (2fx3 A:205-296)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 1544127Species Escherichia coli [TaxId:562] [50450] (8 PDB entries)
    Uniprot P02990
  8. 1544138Domain d2fx3a1: 2fx3 A:205-296 [134271]
    Other proteins in same PDB: d2fx3a2, d2fx3a3
    automatically matched to d1d8ta1
    complexed with gdp, mg

Details for d2fx3a1

PDB Entry: 2fx3 (more details), 3.4 Å

PDB Description: Crystal Structure Determination of E. coli Elongation Factor, Tu using a Twinned Data Set
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d2fx3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx3a1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d2fx3a1:

Click to download the PDB-style file with coordinates for d2fx3a1.
(The format of our PDB-style files is described here.)

Timeline for d2fx3a1: