![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Hemolysin II regulatory protein, HlyIIR [140197] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [140198] (1 PDB entry) Uniprot Q7X506 4-76 |
![]() | Domain d2fx0a1: 2fx0 A:4-76 [134269] Other proteins in same PDB: d2fx0a2 |
PDB Entry: 2fx0 (more details), 2.4 Å
SCOPe Domain Sequences for d2fx0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg lanelpnfleknq
Timeline for d2fx0a1: