Lineage for d2fx0a1 (2fx0 A:4-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692268Protein Hemolysin II regulatory protein, HlyIIR [140197] (1 species)
  7. 2692269Species Bacillus cereus [TaxId:1396] [140198] (1 PDB entry)
    Uniprot Q7X506 4-76
  8. 2692270Domain d2fx0a1: 2fx0 A:4-76 [134269]
    Other proteins in same PDB: d2fx0a2

Details for d2fx0a1

PDB Entry: 2fx0 (more details), 2.4 Å

PDB Description: Crystal Structure of HlyIIR, a Hemolysin II transcriptional Regulator
PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2fx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
lanelpnfleknq

SCOPe Domain Coordinates for d2fx0a1:

Click to download the PDB-style file with coordinates for d2fx0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fx0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fx0a2