Lineage for d2fwwd_ (2fww D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1127877Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 1127878Species Human (Homo sapiens) [TaxId:9606] [50547] (13 PDB entries)
  8. 1127902Domain d2fwwd_: 2fww D: [134266]
    automated match to d1a0la_
    complexed with c1r

Details for d2fwwd_

PDB Entry: 2fww (more details), 2.25 Å

PDB Description: human beta-tryptase ii complexed with 4-piperidinebutyrate to make acylenzyme
PDB Compounds: (D:) Tryptase beta-2

SCOPe Domain Sequences for d2fwwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwwd_ b.47.1.2 (D:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2fwwd_:

Click to download the PDB-style file with coordinates for d2fwwd_.
(The format of our PDB-style files is described here.)

Timeline for d2fwwd_: