Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein beta-Tryptase [50546] (1 species) ring-like tetramer with active sites facing a central pore |
Species Human (Homo sapiens) [TaxId:9606] [50547] (8 PDB entries) |
Domain d2fwwd1: 2fww D:16-244 [134266] automatically matched to d1a0la_ complexed with c1r |
PDB Entry: 2fww (more details), 2.25 Å
SCOP Domain Sequences for d2fwwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fwwd1 b.47.1.2 (D:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy vpk
Timeline for d2fwwd1: