SCOP 1.73: Domain d2fwwd1: 2fww D:16-244

Lineage for d2fwwd1 (2fww D:16-244)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (8 PDB entries)

8. Domain d2fwwd1: 2fww D:16-244 [134266]
   automatically matched to d1a0la_
   complexed with c1r

Details for d2fwwd1

PDB Entry: 2fww, 2.25 Å

PDB Description: human beta-tryptase ii complexed with 4-piperidinebutyrate to make acylenzyme

PDB Compounds: (D:) Tryptase beta-2

SCOP Domain Sequences for d2fwwd1:

Sequence; same for both SEQRES and ATOM records:

>d2fwwd1 b.47.1.2 (D:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2fwwd1:

• d2fwwd1 is new in SCOP 1.73
  
• d2fwwd1 appears in SCOP 1.75
  
• d2fwwd1 appears in the current release, SCOPe 2.08, called d2fwwd_