| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.27: CalX-like [141072] (2 families) ![]() |
| Family b.1.27.1: CalX-beta domain [141073] (2 proteins) Pfam PF03160 |
| Protein Sodium/calcium exchanger 1 [141074] (1 species) |
| Species Dog (Canis familiaris) [TaxId:9615] [141075] (3 PDB entries) Uniprot P23685 402-534! Uniprot P23685 403-541! Uniprot P23685 533-724 |
| Domain d2fwua1: 2fwu A:501-657 [134262] 2nd CalX-beta domain complexed with ca |
PDB Entry: 2fwu (more details)
SCOPe Domain Sequences for d2fwua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fwua1 b.1.27.1 (A:501-657) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
hagiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedfedtcgel
efqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyddkqplts
keeeerriaemgrpilgehtkleviieesyefkstvd
Timeline for d2fwua1: