Lineage for d2fwua1 (2fwu A:501-657)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771426Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 1771427Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
    Pfam PF03160
  6. 1771428Protein Sodium/calcium exchanger 1 [141074] (1 species)
  7. 1771429Species Dog (Canis familiaris) [TaxId:9615] [141075] (3 PDB entries)
    Uniprot P23685 402-534! Uniprot P23685 403-541! Uniprot P23685 533-724
  8. 1771432Domain d2fwua1: 2fwu A:501-657 [134262]
    2nd CalX-beta domain
    complexed with ca

Details for d2fwua1

PDB Entry: 2fwu (more details)

PDB Description: second ca2+ binding domain of the na,ca-exchanger (ncx1)
PDB Compounds: (A:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d2fwua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwua1 b.1.27.1 (A:501-657) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
hagiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedfedtcgel
efqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyddkqplts
keeeerriaemgrpilgehtkleviieesyefkstvd

SCOPe Domain Coordinates for d2fwua1:

Click to download the PDB-style file with coordinates for d2fwua1.
(The format of our PDB-style files is described here.)

Timeline for d2fwua1: