Lineage for d2fwsa1 (2fws A:371-509)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2039949Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2039950Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
    Pfam PF03160
  6. 2039951Protein Sodium/calcium exchanger 1 [141074] (1 species)
  7. 2039952Species Dog (Canis familiaris) [TaxId:9615] [141075] (3 PDB entries)
    Uniprot P23685 402-534! Uniprot P23685 403-541! Uniprot P23685 533-724
  8. 2039954Domain d2fwsa1: 2fws A:371-509 [134261]
    1st CalX-beta domain
    complexed with ca

Details for d2fwsa1

PDB Entry: 2fws (more details)

PDB Description: first ca2+ binding domain of the na,ca-exchanger (ncx1)
PDB Compounds: (A:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d2fwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwsa1 b.1.27.1 (A:371-509) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
vskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtvv
fkpgetqkeirvgiidddifeedenflvhlsnvkvsseasedgileanhvsalaclgsps
tatvtifdddhagiftfee

SCOPe Domain Coordinates for d2fwsa1:

Click to download the PDB-style file with coordinates for d2fwsa1.
(The format of our PDB-style files is described here.)

Timeline for d2fwsa1: