Lineage for d2fwsa1 (2fws A:371-509)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 659302Superfamily b.1.27: CalX-like [141072] (1 family) (S)
  5. 659303Family b.1.27.1: CalX-beta domain [141073] (1 protein)
    Pfam PF03160
  6. 659304Protein Sodium/calcium exchanger 1 [141074] (1 species)
  7. 659305Species Dog (Canis familiaris) [TaxId:9615] [141075] (3 PDB entries)
  8. 659307Domain d2fwsa1: 2fws A:371-509 [134261]
    1st CalX-beta domain
    complexed with ca

Details for d2fwsa1

PDB Entry: 2fws (more details)

PDB Description: first ca2+ binding domain of the na,ca-exchanger (ncx1)
PDB Compounds: (A:) Sodium/calcium exchanger 1

SCOP Domain Sequences for d2fwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwsa1 b.1.27.1 (A:371-509) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
vskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtvv
fkpgetqkeirvgiidddifeedenflvhlsnvkvsseasedgileanhvsalaclgsps
tatvtifdddhagiftfee

SCOP Domain Coordinates for d2fwsa1:

Click to download the PDB-style file with coordinates for d2fwsa1.
(The format of our PDB-style files is described here.)

Timeline for d2fwsa1: