SCOP 1.73: Domain d2fwrb1: 2fwr B:257-454

Lineage for d2fwrb1 (2fwr B:257-454)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein DNA repair protein RAD25 [142318] (1 species)
   shares with the DNA helicase UvsW (scop_fa 102396) extra N-terminal alpha+beta subdomain that might be related to the DNA repair protein MutS domain I (scop_sf 55271)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142319] (3 PDB entries)

8. Domain d2fwrb1: 2fwr B:257-454 [134255]
   automatically matched to 2FWR A:257-456
   complexed with ipa, po4

Details for d2fwrb1

PDB Entry: 2fwr, 2.6 Å

PDB Description: structure of archaeoglobus fulgidis xpb

PDB Compounds: (B:) DNA repair protein RAD25

SCOP Domain Sequences for d2fwrb1:

Sequence, based on SEQRES records:

>d2fwrb1 c.37.1.19 (B:257-454) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}
khlakytikrifvplaederveyekrekvykqflrargitlrraedfnkivmasgydera
yealraweearriafnsknkirklreilerhrkdkiiiftrhnelvyriskvflipaith
rtsreereeilegfrtgrfraivssqvldegidvpdanvgvimsgsgsareyiqrlgril
rpskgkkeavlyelisrg

Sequence, based on observed residues (ATOM records):

>d2fwrb1 c.37.1.19 (B:257-454) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}
khkytikrifvplaederveyekrekvykqflrargitrraedfnkivmyealraweear
riafnsknkirklreilerhrkdkiiiftrhnelvyriskvflipaithrtsreereeil
egfrtgrfraivssqvldegidvpdanvgvimsgsgsareyiqrlgrilrpskgkkeavl
yelisrg

Timeline for d2fwrb1:

• d2fwrb1 is new in SCOP 1.73
  
• d2fwrb1 appears in SCOP 1.75
  
• d2fwrb1 appears in the current release, SCOPe 2.08