Lineage for d2fwna2 (2fwn A:2-181)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361464Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1361488Protein Benzoylformate decarboxylase [88731] (1 species)
  7. 1361489Species Pseudomonas putida [TaxId:303] [88732] (10 PDB entries)
    Uniprot P20906
  8. 1361495Domain d2fwna2: 2fwn A:2-181 [134250]
    Other proteins in same PDB: d2fwna1, d2fwna3
    automated match to d1mcza2
    complexed with ca, mg, tdp

Details for d2fwna2

PDB Entry: 2fwn (more details), 1.4 Å

PDB Description: phosphorylation of an active site serine in a thdp-dependent enzyme by phosphonate inactivation
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d2fwna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwna2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOPe Domain Coordinates for d2fwna2:

Click to download the PDB-style file with coordinates for d2fwna2.
(The format of our PDB-style files is described here.)

Timeline for d2fwna2: