Lineage for d2fwna1 (2fwn A:182-341)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 985972Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 985973Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 986002Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 986026Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 986027Species Pseudomonas putida [TaxId:303] [52483] (9 PDB entries)
    Uniprot P20906
  8. 986033Domain d2fwna1: 2fwn A:182-341 [134249]
    Other proteins in same PDB: d2fwna2, d2fwna3
    automatically matched to d1bfd_1
    complexed with ca, mg, tdp

Details for d2fwna1

PDB Entry: 2fwn (more details), 1.4 Å

PDB Description: phosphorylation of an active site serine in a thdp-dependent enzyme by phosphonate inactivation
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d2fwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwna1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d2fwna1:

Click to download the PDB-style file with coordinates for d2fwna1.
(The format of our PDB-style files is described here.)

Timeline for d2fwna1: