SCOPe 2.08: Domain d2fwlb_: 2fwl B:

Lineage for d2fwlb_ (2fwl B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)

8. Domain d2fwlb_: 2fwl B: [134248]
   Other proteins in same PDB: d2fwla_
   automated match to d2cuab_
   complexed with cua, hec

Details for d2fwlb_

PDB Entry: 2fwl

PDB Description: The cytochrome c552/CuA complex from Thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit II

SCOPe Domain Sequences for d2fwlb_:

Sequence; same for both SEQRES and ATOM records:

>d2fwlb_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
ytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnp
ievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycg
lghqnmfgtivvke

Timeline for d2fwlb_:

• d2fwlb_ first appeared in SCOP 1.73, called d2fwlb1
  
• d2fwlb_ appears in SCOPe 2.07