| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Cytochrome c552 [46636] (6 species) |
| Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries) Uniprot P04164 |
| Domain d2fwla_: 2fwl A: [134247] Other proteins in same PDB: d2fwlb_ automated match to d1c52a_ complexed with cua, hec |
PDB Entry: 2fwl (more details)
SCOPe Domain Sequences for d2fwla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fwla_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk
Timeline for d2fwla_: