SCOPe 2.08: Domain d2fwla_: 2fwl A:

Lineage for d2fwla_ (2fwl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c552 [46636] (6 species)

7. Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries)
   Uniprot P04164

8. Domain d2fwla_: 2fwl A: [134247]
   Other proteins in same PDB: d2fwlb_
   automated match to d1c52a_
   complexed with cua, hec

Details for d2fwla_

PDB Entry: 2fwl

PDB Description: The cytochrome c552/CuA complex from Thermus thermophilus

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d2fwla_:

Sequence; same for both SEQRES and ATOM records:

>d2fwla_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk

Timeline for d2fwla_:

• d2fwla_ first appeared in SCOP 1.73, called d2fwla1
  
• d2fwla_ appears in SCOPe 2.07