SCOPe 2.05: Domain d2fwjb_: 2fwj B:

Lineage for d2fwjb_ (2fwj B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families)

5. Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
   automatically mapped to Pfam PF00731

6. Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)

7. Species Acetobacter aceti [TaxId:435] [110480] (11 PDB entries)
   Uniprot Q72LC1

8. Domain d2fwjb_: 2fwj B: [134244]
   automated match to d1u11b_
   complexed with air

Details for d2fwjb_

PDB Entry: 2fwj, 1.95 Å

PDB Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium Acetobacter aceti, complexed with AIR (5-aminoimidazole ribonucleotide)

PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d2fwjb_:

Sequence; same for both SEQRES and ATOM records:

>d2fwjb_ c.23.8.1 (B:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspit

Timeline for d2fwjb_:

• d2fwjb_ first appeared in SCOP 1.73, called d2fwjb1
  
• d2fwjb_ appears in SCOPe 2.04
  
• d2fwjb_ appears in SCOPe 2.06
  
• d2fwjb_ appears in the current release, SCOPe 2.08