SCOP 1.73: Domain d2fwjb1: 2fwj B:20-178

Lineage for d2fwjb1 (2fwj B:20-178)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family)

5. Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)

6. Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)

7. Species Acetobacter aceti [TaxId:435] [110480] (3 PDB entries)

8. Domain d2fwjb1: 2fwj B:20-178 [134244]
   automatically matched to d1u11b_
   complexed with air

Details for d2fwjb1

PDB Entry: 2fwj, 1.95 Å

PDB Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium Acetobacter aceti, complexed with AIR (5-aminoimidazole ribonucleotide)

PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOP Domain Sequences for d2fwjb1:

Sequence; same for both SEQRES and ATOM records:

>d2fwjb1 c.23.8.1 (B:20-178) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspi

Timeline for d2fwjb1:

• d2fwjb1 is new in SCOP 1.73
  
• d2fwjb1 appears in SCOP 1.75
  
• d2fwjb1 appears in the current release, SCOPe 2.08, called d2fwjb_