Lineage for d2fwja1 (2fwj A:20-178)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692273Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) (S)
  5. 692274Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)
  6. 692275Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 692276Species Acetobacter aceti [TaxId:435] [110480] (3 PDB entries)
  8. 692281Domain d2fwja1: 2fwj A:20-178 [134243]
    automatically matched to d1u11b_
    complexed with air

Details for d2fwja1

PDB Entry: 2fwj (more details), 1.95 Å

PDB Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium Acetobacter aceti, complexed with AIR (5-aminoimidazole ribonucleotide)
PDB Compounds: (A:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOP Domain Sequences for d2fwja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwja1 c.23.8.1 (A:20-178) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspi

SCOP Domain Coordinates for d2fwja1:

Click to download the PDB-style file with coordinates for d2fwja1.
(The format of our PDB-style files is described here.)

Timeline for d2fwja1: