SCOPe 2.07: Domain d2fwga2: 2fwg A:427-543

Lineage for d2fwga2 (2fwg A:427-543)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)

7. Species Escherichia coli [TaxId:562] [102436] (5 PDB entries)

8. Domain d2fwga2: 2fwg A:427-543 [134241]
   Other proteins in same PDB: d2fwga3
   automated match to d1uc7a_

Details for d2fwga2

PDB Entry: 2fwg, 1.1 Å

PDB Description: high resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (photoreduced form)

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d2fwga2:

Sequence; same for both SEQRES and ATOM records:

>d2fwga2 c.47.1.1 (A:427-543) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
thlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvl
lqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrd

Timeline for d2fwga2:

• d2fwga2 first appeared in SCOP 1.73, called d2fwga1
  
• d2fwga2 appears in SCOPe 2.06
  
• d2fwga2 appears in the current release, SCOPe 2.08