Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species) |
Species Escherichia coli [TaxId:562] [102436] (5 PDB entries) |
Domain d2fwga_: 2fwg A: [134241] automated match to d1uc7a_ |
PDB Entry: 2fwg (more details), 1.1 Å
SCOPe Domain Sequences for d2fwga_:
Sequence, based on SEQRES records: (download)
>d2fwga_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} thlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvl lqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqp hhhhh
>d2fwga_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} thlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvl lqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdhhh hh
Timeline for d2fwga_: