Lineage for d2fwga_ (2fwg A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168058Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1168110Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)
  7. 1168115Species Escherichia coli [TaxId:562] [102436] (5 PDB entries)
  8. 1168117Domain d2fwga_: 2fwg A: [134241]
    automated match to d1uc7a_

Details for d2fwga_

PDB Entry: 2fwg (more details), 1.1 Å

PDB Description: high resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (photoreduced form)
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d2fwga_:

Sequence, based on SEQRES records: (download)

>d2fwga_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
thlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvl
lqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqp
hhhhh

Sequence, based on observed residues (ATOM records): (download)

>d2fwga_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
thlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvl
lqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdhhh
hh

SCOPe Domain Coordinates for d2fwga_:

Click to download the PDB-style file with coordinates for d2fwga_.
(The format of our PDB-style files is described here.)

Timeline for d2fwga_: