Lineage for d2fwea2 (2fwe A:428-546)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484117Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)
  7. 2484124Species Escherichia coli [TaxId:562] [102436] (5 PDB entries)
  8. 2484128Domain d2fwea2: 2fwe A:428-546 [134239]
    Other proteins in same PDB: d2fwea3
    automated match to d1uc7a_
    complexed with iod, na, ni

Details for d2fwea2

PDB Entry: 2fwe (more details), 1.65 Å

PDB Description: crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (oxidized form)
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d2fwea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwea2 c.47.1.1 (A:428-546) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqp

SCOPe Domain Coordinates for d2fwea2:

Click to download the PDB-style file with coordinates for d2fwea2.
(The format of our PDB-style files is described here.)

Timeline for d2fwea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fwea3