Lineage for d2fwea1 (2fwe A:428-546)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 699034Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species)
  7. 699035Species Escherichia coli [TaxId:562] [102436] (6 PDB entries)
  8. 699039Domain d2fwea1: 2fwe A:428-546 [134239]
    automatically matched to d1uc7a_
    complexed with iod, na, ni

Details for d2fwea1

PDB Entry: 2fwe (more details), 1.65 Å

PDB Description: crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (oxidized form)
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d2fwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwea1 c.47.1.1 (A:428-546) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqp

SCOP Domain Coordinates for d2fwea1:

Click to download the PDB-style file with coordinates for d2fwea1.
(The format of our PDB-style files is described here.)

Timeline for d2fwea1: