| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species) |
| Species Escherichia coli [TaxId:562] [102436] (5 PDB entries) |
| Domain d2fwea2: 2fwe A:428-546 [134239] Other proteins in same PDB: d2fwea3 automated match to d1uc7a_ complexed with iod, na, ni |
PDB Entry: 2fwe (more details), 1.65 Å
SCOPe Domain Sequences for d2fwea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fwea2 c.47.1.1 (A:428-546) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqp
Timeline for d2fwea2: