SCOP 1.73: Domain d2fw4b1: 2fw4 B:5-260

Lineage for d2fw4b1 (2fw4 B:5-260)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (14 PDB entries)

8. Domain d2fw4b1: 2fw4 B:5-260 [134238]
   automatically matched to d1bzm__
   complexed with his, zn

Details for d2fw4b1

PDB Entry: 2fw4, 2 Å

PDB Description: carbonic anhydrase activators. the first x-ray crystallographic study of an activator of isoform i, structure with l-histidine.

PDB Compounds: (B:) Carbonic anhydrase 1

SCOP Domain Sequences for d2fw4b1:

Sequence; same for both SEQRES and ATOM records:

>d2fw4b1 b.74.1.1 (B:5-260) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d2fw4b1:

• d2fw4b1 is new in SCOP 1.73
  
• d2fw4b1 appears in SCOP 1.75
  
• d2fw4b1 appears in the current release, SCOPe 2.08, called d2fw4b_