Lineage for d2fw4a_ (2fw4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2401370Protein Carbonic anhydrase [51071] (10 species)
  7. 2401379Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)
  8. 2401391Domain d2fw4a_: 2fw4 A: [134237]
    automated match to d1bzm__
    complexed with his, zn

Details for d2fw4a_

PDB Entry: 2fw4 (more details), 2 Å

PDB Description: carbonic anhydrase activators. the first x-ray crystallographic study of an activator of isoform i, structure with l-histidine.
PDB Compounds: (A:) Carbonic anhydrase 1

SCOPe Domain Sequences for d2fw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fw4a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

SCOPe Domain Coordinates for d2fw4a_:

Click to download the PDB-style file with coordinates for d2fw4a_.
(The format of our PDB-style files is described here.)

Timeline for d2fw4a_: