SCOP 1.73: Domain d2fw2f1: 2fw2 F:3-260

Lineage for d2fw2f1 (2fw2 F:3-260)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein Chromodomain protein CDY2A [142002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142003] (1 PDB entry)

8. Domain d2fw2f1: 2fw2 F:3-260 [134236]
   automatically matched to 2FW2 A:3-260

Details for d2fw2f1

PDB Entry: 2fw2, 2.2 Å

PDB Description: catalytic domain of cdy

PDB Compounds: (F:) Testis-specific chromodomain protein Y 2

SCOP Domain Sequences for d2fw2f1:

Sequence; same for both SEQRES and ATOM records:

>d2fw2f1 c.14.1.3 (F:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikemvnalnsaaaddsklvlfsaagsvfc
cgldfgyfvrhlrndrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynaivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlkyvenkidef

Timeline for d2fw2f1:

• d2fw2f1 is new in SCOP 1.73
  
• d2fw2f1 appears in SCOP 1.75
  
• d2fw2f1 appears in the current release, SCOPe 2.08, called d2fw2f_