![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (4 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (13 proteins) |
![]() | Protein Chromodomain protein CDY2A [142002] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142003] (1 PDB entry) |
![]() | Domain d2fw2e1: 2fw2 E:3-260 [134235] automatically matched to 2FW2 A:3-260 |
PDB Entry: 2fw2 (more details), 2.2 Å
SCOP Domain Sequences for d2fw2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fw2e1 c.14.1.3 (E:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} yrdivvkkedgftqivlstrsteknalntevikemvnalnsaaaddsklvlfsaagsvfc cgldfgyfvrhlrndrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv sqvfltgtftqevmiqikelasynaivleeckalvrcnikleleqanerecevlrkiwss aqgiesmlkyvenkidef
Timeline for d2fw2e1: