Lineage for d2fw2e_ (2fw2 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853126Protein Chromodomain protein CDY2A [142002] (1 species)
  7. 2853127Species Human (Homo sapiens) [TaxId:9606] [142003] (1 PDB entry)
    Uniprot Q9Y6F7 284-541
  8. 2853132Domain d2fw2e_: 2fw2 E: [134235]
    automated match to d2fw2a1

Details for d2fw2e_

PDB Entry: 2fw2 (more details), 2.2 Å

PDB Description: catalytic domain of cdy
PDB Compounds: (E:) Testis-specific chromodomain protein Y 2

SCOPe Domain Sequences for d2fw2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fw2e_ c.14.1.3 (E:) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]}
tyrdivvkkedgftqivlstrsteknalntevikemvnalnsaaaddsklvlfsaagsvf
ccgldfgyfvrhlrndrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilpl
cdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakgl
vsqvfltgtftqevmiqikelasynaivleeckalvrcnikleleqanerecevlrkiws
saqgiesmlkyvenkidef

SCOPe Domain Coordinates for d2fw2e_:

Click to download the PDB-style file with coordinates for d2fw2e_.
(The format of our PDB-style files is described here.)

Timeline for d2fw2e_: