SCOPe 2.06: Domain d2fw2a1: 2fw2 A:3-260

Lineage for d2fw2a1 (2fw2 A:3-260)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein Chromodomain protein CDY2A [142002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142003] (1 PDB entry)
   Uniprot Q9Y6F7 284-541

8. Domain d2fw2a1: 2fw2 A:3-260 [134231]

Details for d2fw2a1

PDB Entry: 2fw2, 2.2 Å

PDB Description: catalytic domain of cdy

PDB Compounds: (A:) Testis-specific chromodomain protein Y 2

SCOPe Domain Sequences for d2fw2a1:

Sequence; same for both SEQRES and ATOM records:

>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikemvnalnsaaaddsklvlfsaagsvfc
cgldfgyfvrhlrndrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynaivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlkyvenkidef

Timeline for d2fw2a1:

• d2fw2a1 first appeared in SCOP 1.73
  
• d2fw2a1 appears in SCOPe 2.05
  
• d2fw2a1 appears in SCOPe 2.07
  
• d2fw2a1 appears in the current release, SCOPe 2.08