Lineage for d2fw2a1 (2fw2 A:3-260)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690816Protein Chromodomain protein CDY2A [142002] (1 species)
  7. 690817Species Human (Homo sapiens) [TaxId:9606] [142003] (1 PDB entry)
  8. 690818Domain d2fw2a1: 2fw2 A:3-260 [134231]

Details for d2fw2a1

PDB Entry: 2fw2 (more details), 2.2 Å

PDB Description: catalytic domain of cdy
PDB Compounds: (A:) Testis-specific chromodomain protein Y 2

SCOP Domain Sequences for d2fw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikemvnalnsaaaddsklvlfsaagsvfc
cgldfgyfvrhlrndrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynaivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlkyvenkidef

SCOP Domain Coordinates for d2fw2a1:

Click to download the PDB-style file with coordinates for d2fw2a1.
(The format of our PDB-style files is described here.)

Timeline for d2fw2a1: