Lineage for d2fw1b1 (2fw1 B:20-178)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) 
Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein) Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species) 
Species Acetobacter aceti [TaxId:435] [110480] (3 PDB entries) 
Domain d2fw1b1: 2fw1 B:20-178 [134230]
automatically matched to d1u11b_
complexed with acy
Details for d2fw1b1
PDB Entry: 2fw1 (more details), 2 Å
PDB Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium Acetobacter aceti, at pH 8.5
PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutaseSCOP Domain Sequences for d2fw1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fw1b1 c.23.8.1 (B:20-178) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspi
SCOP Domain Coordinates for d2fw1b1:
Click to download the PDB-style file with coordinates for d2fw1b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fw1b1:
- d2fw1b1 is new in SCOP 1.73
- d2fw1b1 appears in SCOP 1.75
- d2fw1b1 appears in the current release, SCOPe 2.08, called d2fw1b_
View in 3D
