![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein Diphosphoinositol polyphosphate phosphohydrolase [143766] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143767] (2 PDB entries) Uniprot O95989 8-142 |
![]() | Domain d2fvva1: 2fvv A:8-142 [134226] complexed with cl, ihp, so4 |
PDB Entry: 2fvv (more details), 1.25 Å
SCOPe Domain Sequences for d2fvva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} qtrtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrev ceeagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaik vlqyhkpvqasyfet
Timeline for d2fvva1: