SCOPe 2.06: Domain d2fvta1: 2fvt A:1-127

Lineage for d2fvta1 (2fvt A:1-127)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.103: MTH938-like [64075] (1 superfamily)
   core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest

4. Superfamily c.103.1: MTH938-like [64076] (1 family)
   automatically mapped to Pfam PF04430

5. Family c.103.1.1: MTH938-like [64077] (5 proteins)

6. Protein Hypothetical protein RPA2829 [142437] (1 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [142438] (1 PDB entry)
   Uniprot Q6N5Y9 1-127

8. Domain d2fvta1: 2fvt A:1-127 [134225]
   Other proteins in same PDB: d2fvta2

Details for d2fvta1

PDB Entry: 2fvt

PDB Description: nmr structure of the rpa2829 protein from rhodopseudomonas palustris: northeast structural genomics target rpr43

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fvta1:

Sequence; same for both SEQRES and ATOM records:

>d2fvta1 c.103.1.1 (A:1-127) Hypothetical protein RPA2829 {Rhodopseudomonas palustris [TaxId: 1076]}
maqrseiphfprtaaidaygkggfyfagmshqgsllflpdavwgwdvtkpeqidryslqr
vfdnanaidtlivgtgadvwiaprqlrealrgvnvvldtmqtgpairtynimigerrrva
aaliavp

Timeline for d2fvta1:

• d2fvta1 first appeared in SCOP 1.73
  
• d2fvta1 appears in SCOPe 2.05
  
• d2fvta1 appears in SCOPe 2.07
  
• d2fvta1 appears in the current release, SCOPe 2.08