Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.103: MTH938-like [64075] (1 superfamily) core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest |
Superfamily c.103.1: MTH938-like [64076] (1 family) |
Family c.103.1.1: MTH938-like [64077] (5 proteins) |
Protein Hypothetical protein RPA2829 [142437] (1 species) |
Species Rhodopseudomonas palustris [TaxId:1076] [142438] (1 PDB entry) Uniprot Q6N5Y9 1-127 |
Domain d2fvta1: 2fvt A:1-127 [134225] |
PDB Entry: 2fvt (more details)
SCOP Domain Sequences for d2fvta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fvta1 c.103.1.1 (A:1-127) Hypothetical protein RPA2829 {Rhodopseudomonas palustris [TaxId: 1076]} maqrseiphfprtaaidaygkggfyfagmshqgsllflpdavwgwdvtkpeqidryslqr vfdnanaidtlivgtgadvwiaprqlrealrgvnvvldtmqtgpairtynimigerrrva aaliavp
Timeline for d2fvta1: