Lineage for d2fvta1 (2fvt A:1-127)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712110Fold c.103: MTH938-like [64075] (1 superfamily)
    core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest
  4. 712111Superfamily c.103.1: MTH938-like [64076] (1 family) (S)
  5. 712112Family c.103.1.1: MTH938-like [64077] (5 proteins)
  6. 712129Protein Hypothetical protein RPA2829 [142437] (1 species)
  7. 712130Species Rhodopseudomonas palustris [TaxId:1076] [142438] (1 PDB entry)
  8. 712131Domain d2fvta1: 2fvt A:1-127 [134225]

Details for d2fvta1

PDB Entry: 2fvt (more details)

PDB Description: nmr structure of the rpa2829 protein from rhodopseudomonas palustris: northeast structural genomics target rpr43
PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d2fvta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fvta1 c.103.1.1 (A:1-127) Hypothetical protein RPA2829 {Rhodopseudomonas palustris [TaxId: 1076]}
maqrseiphfprtaaidaygkggfyfagmshqgsllflpdavwgwdvtkpeqidryslqr
vfdnanaidtlivgtgadvwiaprqlrealrgvnvvldtmqtgpairtynimigerrrva
aaliavp

SCOP Domain Coordinates for d2fvta1:

Click to download the PDB-style file with coordinates for d2fvta1.
(The format of our PDB-style files is described here.)

Timeline for d2fvta1: