Class b: All beta proteins [48724] (180 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
Protein Dihydropyrimidine amidohydrolase Pyd2 [141683] (2 species) |
Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [141684] (3 PDB entries) Uniprot Q9P903 2-56,441-541 |
Domain d2fvma1: 2fvm A:2-56,A:441-541 [134212] Other proteins in same PDB: d2fvma2, d2fvmb2, d2fvmc2, d2fvmd2 automated match to d2ftya1 complexed with urp, zn |
PDB Entry: 2fvm (more details), 2.45 Å
SCOPe Domain Sequences for d2fvma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fvma1 b.92.1.3 (A:2-56,A:441-541) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpXilpg vsdadlviwypddskkeynskpklitnklmehncdytpfegieiknwprytivkgkivyk egeilkenadgkylkrgksfmctpknewvtewrpkye
Timeline for d2fvma1: