| Class b: All beta proteins [48724] (174 folds) |
| Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
| Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
| Protein Dihydropyrimidine amidohydrolase Pyd2 [141683] (2 species) |
| Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [141684] (3 PDB entries) Uniprot Q9P903 2-56,441-541 |
| Domain d2fvkd1: 2fvk D:2-56,D:441-541 [134210] Other proteins in same PDB: d2fvka2, d2fvkb2, d2fvkc2, d2fvkd2 automatically matched to 2FTY A:2-56,A:441-541 complexed with duc, zn |
PDB Entry: 2fvk (more details), 2.4 Å
SCOP Domain Sequences for d2fvkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fvkd1 b.92.1.3 (D:2-56,D:441-541) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}
piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpXilpg
vsdadlviwypddskkeynskpklitnklmehncdytpfegieiknwprytivkgkivyk
egeilkenadgkylkrgksfmctpknewvtewrpkye
Timeline for d2fvkd1: