Lineage for d2fvka2 (2fvk A:57-440)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084618Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 protein domains)
    automatically mapped to Pfam PF13147
  6. 2084652Protein Dihydropyrimidine amidohydrolase Pyd2 [141805] (2 species)
  7. 2084655Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [141806] (3 PDB entries)
    Uniprot Q9P903 57-440
  8. 2084656Domain d2fvka2: 2fvk A:57-440 [134205]
    Other proteins in same PDB: d2fvka1, d2fvkb1, d2fvkc1, d2fvkd1
    automated match to d2ftya2
    complexed with duc, zn

Details for d2fvka2

PDB Entry: 2fvk (more details), 2.4 Å

PDB Description: Crystal structure of dihydropyrimidinase from Saccharomyces kluyveri in complex with the substrate dihydrouracil
PDB Compounds: (A:) dihydropyrimidinase

SCOPe Domain Sequences for d2fvka2:

Sequence, based on SEQRES records: (download)

>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}
ggidahvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkl
dvdeyseqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglq
isdydimsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegea
tnraitlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhh
gevesygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivg
sdhcsynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnlts
mmklveiqctnpakvygmypqkgs

Sequence, based on observed residues (ATOM records): (download)

>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}
ggidahvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkl
dvdeyseqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglq
isdydimsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegea
tnraitlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchgv
gidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsyny
yektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiq
ctnpakvygmypqkgs

SCOPe Domain Coordinates for d2fvka2:

Click to download the PDB-style file with coordinates for d2fvka2.
(The format of our PDB-style files is described here.)

Timeline for d2fvka2: