Lineage for d2fvga2 (2fvg A:1-64,A:149-339)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703198Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 703269Protein Endoglucanase TM1049 [142516] (1 species)
  7. 703270Species Thermotoga maritima [TaxId:2336] [142517] (1 PDB entry)
  8. 703271Domain d2fvga2: 2fvg A:1-64,A:149-339 [134202]
    Other proteins in same PDB: d2fvga1
    complexed with edo

Details for d2fvga2

PDB Entry: 2fvg (more details), 2.01 Å

PDB Description: crystal structure of endoglucanase (tm1049) from thermotoga maritima at 2.01 a resolution
PDB Compounds: (A:) endoglucanase

SCOP Domain Sequences for d2fvga2:

Sequence, based on SEQRES records: (download)

>d2fvga2 c.56.5.4 (A:1-64,A:149-339) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
mylkelsmmpgvsgdegkvrdfikskieglvdnlytdvlgnlialkrgrdsskkllvsah
mdevXfvsdyiekngravgkafddragcsvlidvlesgvspaydtyfvftvqeetglrgs
avvveqlkptcaivvetttagdnpeleerkwathlgdgpaitfyhrgyvipkeifqtivd
taknndipfqmkrrtaggtdagryartaygvpagvistparyihspnsiidlndyentkk
likvlveegkivevvs

Sequence, based on observed residues (ATOM records): (download)

>d2fvga2 c.56.5.4 (A:1-64,A:149-339) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
mylkelsmmpgvsgdegkvrdfikskieglvdnlytdvlgnlialkrgrdsskkllvsah
mdevXfvsdyiekngravgkafddragcsvlidvlesgvspaydtyfvftvqeesavvve
qlkptcaivvetttagdnpeleerkwathlgdgpaitfyhrgyvipkeifqtivdtaknn
dipfqmkrrtygvpagvistparyihspnsiidlndyentkklikvlveegkivevvs

SCOP Domain Coordinates for d2fvga2:

Click to download the PDB-style file with coordinates for d2fvga2.
(The format of our PDB-style files is described here.)

Timeline for d2fvga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fvga1