SCOPe 2.06: Domain d2fvga1: 2fvg A:65-148

Lineage for d2fvga1 (2fvg A:65-148)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family)

5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)

6. Protein Endoglucanase TM1049 [141391] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141392] (1 PDB entry)
   Uniprot Q9X0D9 65-148

8. Domain d2fvga1: 2fvg A:65-148 [134201]
   Other proteins in same PDB: d2fvga2, d2fvga3
   complexed with edo

Details for d2fvga1

PDB Entry: 2fvg, 2.01 Å

PDB Description: crystal structure of endoglucanase (tm1049) from thermotoga maritima at 2.01 a resolution

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d2fvga1:

Sequence, based on SEQRES records:

>d2fvga1 b.49.3.1 (A:65-148) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
gfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpihlqrdeentpprfen
lridfgfssadeakkyvsigdyvs

Sequence, based on observed residues (ATOM records):

>d2fvga1 b.49.3.1 (A:65-148) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
gfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpprfenlridfgfssad
eakkyvsigdyvs

Timeline for d2fvga1:

• d2fvga1 first appeared in SCOP 1.73
  
• d2fvga1 appears in SCOPe 2.05
  
• d2fvga1 appears in SCOPe 2.07
  
• d2fvga1 appears in the current release, SCOPe 2.08