Lineage for d2fvga1 (2fvg A:65-148)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671859Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 671860Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 671887Protein Endoglucanase TM1049 [141391] (1 species)
  7. 671888Species Thermotoga maritima [TaxId:2336] [141392] (1 PDB entry)
  8. 671889Domain d2fvga1: 2fvg A:65-148 [134201]
    Other proteins in same PDB: d2fvga2
    complexed with edo

Details for d2fvga1

PDB Entry: 2fvg (more details), 2.01 Å

PDB Description: crystal structure of endoglucanase (tm1049) from thermotoga maritima at 2.01 a resolution
PDB Compounds: (A:) endoglucanase

SCOP Domain Sequences for d2fvga1:

Sequence, based on SEQRES records: (download)

>d2fvga1 b.49.3.1 (A:65-148) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
gfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpihlqrdeentpprfen
lridfgfssadeakkyvsigdyvs

Sequence, based on observed residues (ATOM records): (download)

>d2fvga1 b.49.3.1 (A:65-148) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
gfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpprfenlridfgfssad
eakkyvsigdyvs

SCOP Domain Coordinates for d2fvga1:

Click to download the PDB-style file with coordinates for d2fvga1.
(The format of our PDB-style files is described here.)

Timeline for d2fvga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fvga2