Lineage for d2fvga1 (2fvg A:65-148)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2390559Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2390964Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 2390965Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 protein domains)
  6. 2390992Protein Endoglucanase TM1049 [141391] (1 species)
  7. 2390993Species Thermotoga maritima [TaxId:2336] [141392] (1 PDB entry)
    Uniprot Q9X0D9 65-148
  8. 2390994Domain d2fvga1: 2fvg A:65-148 [134201]
    Other proteins in same PDB: d2fvga2, d2fvga3
    complexed with edo

Details for d2fvga1

PDB Entry: 2fvg (more details), 2.01 Å

PDB Description: crystal structure of endoglucanase (tm1049) from thermotoga maritima at 2.01 a resolution
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d2fvga1:

Sequence, based on SEQRES records: (download)

>d2fvga1 b.49.3.1 (A:65-148) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
gfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpihlqrdeentpprfen
lridfgfssadeakkyvsigdyvs

Sequence, based on observed residues (ATOM records): (download)

>d2fvga1 b.49.3.1 (A:65-148) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
gfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpprfenlridfgfssad
eakkyvsigdyvs

SCOPe Domain Coordinates for d2fvga1:

Click to download the PDB-style file with coordinates for d2fvga1.
(The format of our PDB-style files is described here.)

Timeline for d2fvga1: