SCOPe 2.08: Domain d2fv4a1: 2fv4 A:133-221

Lineage for d2fv4a1 (2fv4 A:133-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily)
   core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2)

4. Superfamily d.300.1: Kinetochore globular domain [143026] (2 families)
   swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold

5. Family d.300.1.1: Spc25-like [143027] (2 proteins)
   Pfam PF08234

6. Protein Kinetochore protein Spc25 [143028] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143029] (2 PDB entries)
   Uniprot P40014 133-221

8. Domain d2fv4a1: 2fv4 A:133-221 [134194]
   Other proteins in same PDB: d2fv4b1

Details for d2fv4a1

PDB Entry: 2fv4

PDB Description: nmr solution structure of the yeast kinetochore spc24/spc25 globular domain

PDB Compounds: (A:) Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region

SCOPe Domain Sequences for d2fv4a1:

Sequence; same for both SEQRES and ATOM records:

>d2fv4a1 d.300.1.1 (A:133-221) Kinetochore protein Spc25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndaaevalyerllqlrvlpgasdvhdvrfvfgddsrcwievamhgdhvignshpaldpks
ratlehvltvqgdlaaflvvardmllasl

Timeline for d2fv4a1:

• d2fv4a1 first appeared in SCOP 1.73
  
• d2fv4a1 appears in SCOPe 2.07