SCOPe 2.08: Domain d2furb_: 2fur B:

Lineage for d2furb_ (2fur B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Hypothetical protein Ta1372 [141366] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [141367] (1 PDB entry)
   Uniprot Q9HIG7 16-208

8. Domain d2furb_: 2fur B: [134186]
   automated match to d2fura1
   complexed with edo

Details for d2furb_

PDB Entry: 2fur, 1.8 Å

PDB Description: crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2furb_:

Sequence; same for both SEQRES and ATOM records:

>d2furb_ b.45.1.1 (B:) Hypothetical protein Ta1372 {Thermoplasma acidophilum [TaxId: 2303]}
ysdedlvamldrnftctvsfidggipyaipmmlasegktiylhgsmksriygilktgqli
aislleingivlakeiknnsinyvsalifgrpyeiddtekkievfrllteklvkgrwdns
ikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsgvlpiqhtiseagenapeyv
kslygkrifi

Timeline for d2furb_:

• d2furb_ first appeared in SCOP 1.73, called d2furb1
  
• d2furb_ appears in SCOPe 2.07