![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Hypothetical protein Ta1372 [141366] (1 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [141367] (1 PDB entry) Uniprot Q9HIG7 16-208 |
![]() | Domain d2fura1: 2fur A:16-208 [134185] complexed with edo |
PDB Entry: 2fur (more details), 1.8 Å
SCOPe Domain Sequences for d2fura1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fura1 b.45.1.1 (A:16-208) Hypothetical protein Ta1372 {Thermoplasma acidophilum [TaxId: 2303]} rasysdedlvamldrnftctvsfidggipyaipmmlasegktiylhgsmksriygilktg qliaislleingivlakeiknnsinyvsalifgrpyeiddtekkievfrllteklvkgrw dnsikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsgvlpiqhtiseagenap eyvkslygkrifi
Timeline for d2fura1: