Lineage for d2fura1 (2fur A:16-208)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055234Family b.45.1.1: PNP-oxidase like [50476] (17 protein domains)
  6. 2055306Protein Hypothetical protein Ta1372 [141366] (1 species)
  7. 2055307Species Thermoplasma acidophilum [TaxId:2303] [141367] (1 PDB entry)
    Uniprot Q9HIG7 16-208
  8. 2055308Domain d2fura1: 2fur A:16-208 [134185]
    complexed with edo

Details for d2fura1

PDB Entry: 2fur (more details), 1.8 Å

PDB Description: crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2fura1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fura1 b.45.1.1 (A:16-208) Hypothetical protein Ta1372 {Thermoplasma acidophilum [TaxId: 2303]}
rasysdedlvamldrnftctvsfidggipyaipmmlasegktiylhgsmksriygilktg
qliaislleingivlakeiknnsinyvsalifgrpyeiddtekkievfrllteklvkgrw
dnsikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsgvlpiqhtiseagenap
eyvkslygkrifi

SCOPe Domain Coordinates for d2fura1:

Click to download the PDB-style file with coordinates for d2fura1.
(The format of our PDB-style files is described here.)

Timeline for d2fura1: