SCOPe 2.07: Domain d2fupa1: 2fup A:1-130

Lineage for d2fupa1 (2fup A:1-130)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.5: FlgN-like [140566] (1 family)
   the last helix is shorter than the three others; a short extra helix between helices 2 an 3 fills the gap in the bundle
   automatically mapped to Pfam PF05130

5. Family a.47.5.1: FlgN-like [140567] (1 protein)
   Pfam PF05130

6. Protein Hypothetical protein PA3352 [140568] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140569] (1 PDB entry)
   Uniprot Q9HYP4 1-130

8. Domain d2fupa1: 2fup A:1-130 [134184]
   complexed with mpd

Details for d2fupa1

PDB Entry: 2fup, 1.48 Å

PDB Description: Crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 A resolution

PDB Compounds: (A:) hypothetical protein PA3352

SCOPe Domain Sequences for d2fupa1:

Sequence, based on SEQRES records:

>d2fupa1 a.47.5.1 (A:1-130) Hypothetical protein PA3352 {Pseudomonas aeruginosa [TaxId: 287]}
mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra
raeilreagvsldreglaryareradgaellargdelgellercqqanlrngriiranqa
stgsllnilr

Sequence, based on observed residues (ATOM records):

>d2fupa1 a.47.5.1 (A:1-130) Hypothetical protein PA3352 {Pseudomonas aeruginosa [TaxId: 287]}
mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra
raeilreagvsldreglaryareradgaellargdelgellercqqanlrngrianqast
gsllnilr

Timeline for d2fupa1:

• d2fupa1 first appeared in SCOP 1.73
  
• d2fupa1 appears in SCOPe 2.06
  
• d2fupa1 appears in the current release, SCOPe 2.08