Lineage for d2fupa1 (2fup A:1-130)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642337Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 642386Superfamily a.47.5: FlgN-like [140566] (1 family) (S)
    the last helix is shorter than the three others; a short extra helix between helices 2 an 3 fills the gap in the bundle
  5. 642387Family a.47.5.1: FlgN-like [140567] (1 protein)
    Pfam PF05130
  6. 642388Protein Hypothetical protein PA3352 [140568] (1 species)
  7. 642389Species Pseudomonas aeruginosa [TaxId:287] [140569] (1 PDB entry)
  8. 642390Domain d2fupa1: 2fup A:1-130 [134184]
    complexed with mpd

Details for d2fupa1

PDB Entry: 2fup (more details), 1.48 Å

PDB Description: Crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 A resolution
PDB Compounds: (A:) hypothetical protein PA3352

SCOP Domain Sequences for d2fupa1:

Sequence, based on SEQRES records: (download)

>d2fupa1 a.47.5.1 (A:1-130) Hypothetical protein PA3352 {Pseudomonas aeruginosa [TaxId: 287]}
mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra
raeilreagvsldreglaryareradgaellargdelgellercqqanlrngriiranqa
stgsllnilr

Sequence, based on observed residues (ATOM records): (download)

>d2fupa1 a.47.5.1 (A:1-130) Hypothetical protein PA3352 {Pseudomonas aeruginosa [TaxId: 287]}
mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra
raeilreagvsldreglaryareradgaellargdelgellercqqanlrngrianqast
gsllnilr

SCOP Domain Coordinates for d2fupa1:

Click to download the PDB-style file with coordinates for d2fupa1.
(The format of our PDB-style files is described here.)

Timeline for d2fupa1: