Class a: All alpha proteins [46456] (258 folds) |
Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.5: FlgN-like [140566] (1 family) the last helix is shorter than the three others; a short extra helix between helices 2 an 3 fills the gap in the bundle |
Family a.47.5.1: FlgN-like [140567] (1 protein) Pfam PF05130 |
Protein Hypothetical protein PA3352 [140568] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [140569] (1 PDB entry) |
Domain d2fupa1: 2fup A:1-130 [134184] complexed with mpd |
PDB Entry: 2fup (more details), 1.48 Å
SCOP Domain Sequences for d2fupa1:
Sequence, based on SEQRES records: (download)
>d2fupa1 a.47.5.1 (A:1-130) Hypothetical protein PA3352 {Pseudomonas aeruginosa [TaxId: 287]} mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra raeilreagvsldreglaryareradgaellargdelgellercqqanlrngriiranqa stgsllnilr
>d2fupa1 a.47.5.1 (A:1-130) Hypothetical protein PA3352 {Pseudomonas aeruginosa [TaxId: 287]} mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra raeilreagvsldreglaryareradgaellargdelgellercqqanlrngrianqast gsllnilr
Timeline for d2fupa1: