Lineage for d2fuma_ (2fum A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588936Protein Mycobacterial protein kinase PknB, catalytic domain [82793] (1 species)
    OPK group; PKN subfamily; serine/threonine kinase
  7. 2588937Species Mycobacterium tuberculosis [TaxId:1773] [82794] (4 PDB entries)
  8. 2588939Domain d2fuma_: 2fum A: [134176]
    automated match to d1o6ya_
    complexed with mix

Details for d2fuma_

PDB Entry: 2fum (more details), 2.89 Å

PDB Description: Catalytic domain of protein kinase PknB from Mycobacterium tuberculosis in complex with mitoxantrone
PDB Compounds: (A:) Probable serine/threonine-protein kinase pknB

SCOPe Domain Sequences for d2fuma_:

Sequence, based on SEQRES records: (download)

>d2fuma_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqy
lspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheg
lsadldavvlkalaknpenryqtaaemradlvrvh

Sequence, based on observed residues (ATOM records): (download)

>d2fuma_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadgtaqylspeqargdsvd
arsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlka
laknpenryqtaaemradlvrvh

SCOPe Domain Coordinates for d2fuma_:

Click to download the PDB-style file with coordinates for d2fuma_.
(The format of our PDB-style files is described here.)

Timeline for d2fuma_: